You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| MW | 4493.3 Da |
|---|---|
| Purity | > 95% by HPLC |
| Formula | C205H340N60O53 |
| Protein Sequence | H-Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg-OH |
Storage & Handling
−| Storage | Store dry, dark and frozen |
|---|---|
| Form/Appearance | Freeze dried solid |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−AM002, GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR, LL 37, LL 37 (human) scrambled, LL37, control , hCAP18), host defence peptide, human cathelicidin antimicrobial peptide (CAMP
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
LL 37 (human) scrambled (orb1140565)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days