Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

LL 37 (human) scrambled

SKU: orb1140565

Description

Scrambled control peptide for LL-37; Peptides.

Images & Validation

Key Properties

MW4493.3 Da
Purity> 95% by HPLC
FormulaC205H340N60O53
Protein SequenceH-Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg-OH

Storage & Handling

StorageStore dry, dark and frozen
Form/AppearanceFreeze dried solid
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

AM002, GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR, LL 37, LL 37 (human) scrambled, LL37, control , hCAP18), host defence peptide, human cathelicidin antimicrobial peptide (CAMP

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

1 mg
$ 290.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry