Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

LL 37 (human) biotinylated, pegylated

SKU: orb1140564

Description

N-terminally biotinylated version of the host defence peptide LL 37; Biotin labelled peptides.

Images & Validation

Key Properties

MW4967 Da
Purity> 95% by HPLC
FormulaC226H376N64O59S
Protein SequenceBiotin-[PEG(4)]-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

Storage & Handling

StorageStore frozen, dessicated and in the dark
Form/AppearanceFreeze dried solid
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

, AM-200, AM200, Biotin-[PEG(4)][LL-37, 37 aa]OH, LL 37 (human) biotinylated, LL-37, LL37, [LL-37, 37 aa], PEG(4), angiogenesis, antimicrobial, antitumour, antiviral, biotin, chemotaxis, immunomodulatory, pegylated chain, pegylated is the N-terminally biotinylated
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

1 mg
$ 480.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry