You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| MW | 4967 Da |
|---|---|
| Purity | > 95% by HPLC |
| Formula | C226H376N64O59S |
| Protein Sequence | Biotin-[PEG(4)]-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH |
Storage & Handling
−| Storage | Store frozen, dessicated and in the dark |
|---|---|
| Form/Appearance | Freeze dried solid |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−, AM-200, AM200, Biotin-[PEG(4)][LL-37, 37 aa]OH, LL 37 (human) biotinylated, LL-37, LL37, [LL-37, 37 aa], PEG(4), angiogenesis, antimicrobial, antitumour, antiviral, biotin, chemotaxis, immunomodulatory, pegylated chain, pegylated is the N-terminally biotinylated

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
LL 37 (human) biotinylated, pegylated (orb1140564)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review