LILRA3 Rabbit Polyclonal Antibody

SKU: orb586226

Description

LILRA3 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting LILRA3. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Human. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: LILRA3
• Protein Sequence: Synthetic peptide located within the following region: AADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHP
• Molecular Weight: 47kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

HM31, HM43, ILT6, LIR4, CD85E, ILT-6, LIR-4

Antibody dilution: 1.0 ug/ml, Sample Type: Human Kidney.

Sample Type: Human OVCAR-3, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.0 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane.

Quick Database Links

Gene Symbol

LILRA3

UniProt

Q8N6C8

RefSeq (Protein):NP_006856