You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
LILRA3 Rabbit Polyclonal Antibody
Catalog Number: orb586226
| Catalog Number | orb586226 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to LILRA3 |
| Target | LILRA3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Protein Sequence | Synthetic peptide located within the following region: AADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHP |
| UniProt ID | Q8N6C8 |
| MW | 47kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | HM31, HM43, ILT6, LIR4, CD85E, ILT-6, LIR-4 |
| Note | For research use only |
| NCBI | NP_006856 |
Antibody dilution: 1.0 ug/ml, Sample Type: Human Kidney.
Sample Type: Human OVCAR-3, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.0 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane.
- Item 1 of 2
- Item 1 of 3
- Item 1 of 2
- Item 1 of 1
- Item 1 of 1
