You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586225 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LILRA3 |
Target | LILRA3 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human LILRA3 |
Protein Sequence | Synthetic peptide located within the following region: AHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE |
UniProt ID | Q8N6C8 |
MW | 45kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | HM31, HM43, ILT6, LIR4, CD85E, ILT-6, LIR-4 |
Note | For research use only |
NCBI | NP_006856 |
WB Suggested Anti-LILRA3 Antibody, Titration: 1.0 ug/ml, Positive Control: OVCAR-3 Whole Cell. LILRA3 is supported by BioGPS gene expression data to be expressed in OVCAR3.