You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582475 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to LGALS3BP |
Target | LGALS3BP |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Mouse, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human LGALS3BP |
Protein Sequence | Synthetic peptide located within the following region: NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS |
UniProt ID | Q08380 |
MW | 63kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | 90K, M2BP, gp90, CyCAP, BTBD17B, MAC-2-BP, TANGO10 Read more... |
Note | For research use only |
NCBI | NP_005558 |
Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Positive control (+): Human Placenta (PL), Negative control (-): MCF7 (N10), Antibody concentration: 1 ug/ml.
WB Suggested Anti-LGALS3BP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human brain.
IP, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-Fr, IHC-P, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |