LGALS3BP Rabbit Polyclonal Antibody

• Catalog Number: orb582475
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LGALS3BP
• Target: LGALS3BP
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LGALS3BP
• Protein Sequence: Synthetic peptide located within the following region: NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS
• UniProt ID: Q08380
• MW: 63kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: 90K, M2BP, gp90, CyCAP, BTBD17B, MAC-2-BP, TANGO10
• Note: For research use only
• NCBI: NP_005558

Sample Tissue: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Positive control (+): Human Placenta (PL), Negative control (-): MCF7 (N10), Antibody concentration: 1 ug/ml.

WB Suggested Anti-LGALS3BP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human brain.