LBR Rabbit Polyclonal Antibody

• Catalog Number: orb579422
• Category: Antibodies
• Description: Rabbit polyclonal antibody to LBR
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LBR
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 71kDa
• Target: LBR
• UniProt ID: Q14739
• Protein Sequence: Synthetic peptide located within the following region: GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL
• NCBI: NP_002287
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PHA, C14SR, LMN2R, PHASK, TDRD18, DHCR14B
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Positive control (+): RPMI-8226 (N12), Negative control (-): A549 (N03), Antibody concentration: 1 ug/ml.

LBR was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with orb579422 with 1:200 dilution. Western blot was performed using orb579422 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole cell lysate. Lane 2: LBR IP with orb579422 in HEK293 Whole cell lysate. Lane 3: Input of HEK293 Whole cell lysate.

WB Suggested Anti-LBR Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: RPMI 8226 cell lysate. LBR is supported by BioGPS gene expression data to be expressed in RPMI 8226.