Cart summary

You have no items in your shopping cart.

LASS1 Rabbit Polyclonal Antibody (Biotin)

LASS1 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2112835

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2112835
CategoryAntibodies
DescriptionLASS1 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityEquine, Human, Mouse, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human LASS1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW39kDa
UniProt IDP27544
Protein SequenceSynthetic peptide located within the following region: LYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKR
NCBINP_067090
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesEPM8, GDF1, LAG1, UOG1, GDF-1, LASS1
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.