LASS1 Rabbit Polyclonal Antibody

SKU: orb330596

Description

Rabbit polyclonal antibody to CERS1

Research Area

Metabolism Research

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Equine, Mouse, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LASS1
• Target: CERS1
• Protein Sequence: Synthetic peptide located within the following region: LYIVAFAAKVLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKR
• Molecular Weight: 39kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CerS1 antibody, anti LAG1 antibody, anti MGC90349 antibody, anti UOG1 antibody, anti LASS1 antibody

Sample Tissue: Human PANC1 Whole Cell, Antibody dilution: 2 ug/ml.

Sample Tissue: Human SGC-7901 Whole Cell, Antibody dilution: 5 ug/ml.

Positive control (+): A549 (N03), Negative control (-): U937 (N31), Antibody concentration: 3 ug/ml.

WB Suggested Anti-LASS1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: OVCAR-3 cell lysate.

Quick Database Links

Gene Symbol

CERS1

UniProt

P27544

RefSeq (Protein):NP_067090