You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb578187 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KRT10 |
Target | KRT10 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human KRT10 |
Protein Sequence | Synthetic peptide located within the following region: EKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRD |
UniProt ID | P13645 |
MW | 59kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | BIE, EHK, K10, KPP, BCIE, CK10 |
Note | For research use only |
NCBI | NP_000412 |
Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.
WB Suggested Anti-KRT10 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
FC, ICC | |
Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Mouse | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |