KLF9 Rabbit Polyclonal Antibody

• Catalog Number: orb573770
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KLF9
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KLF9
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 27kDa
• Target: KLF9
• UniProt ID: Q13886
• Protein Sequence: Synthetic peptide located within the following region: LPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLE
• NCBI: NP_001197
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BTEB, BTEB1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human 786-0, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Fetal Liver lysates, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

Rabbit Anti-KL9 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Testis

WB Suggested Anti-KLF9 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat.