KLF9 Rabbit Polyclonal Antibody

SKU: orb573770

Description

Rabbit polyclonal antibody to KLF9

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KLF9
• Target: KLF9
• Protein Sequence: Synthetic peptide located within the following region: LPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLE
• Molecular Weight: 27kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

BTEB, BTEB1

Sample Tissue: Human 786-0, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Fetal Liver lysates, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

Rabbit Anti-KL9 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Testis

WB Suggested Anti-KLF9 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat.

Quick Database Links

Gene Symbol

KLF9

UniProt

Q13886

RefSeq (Protein):NP_001197