You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb576779 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to KLF10 |
| Target | KLF10 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human KLF10 |
| Protein Sequence | Synthetic peptide located within the following region: RTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDI |
| UniProt ID | Q13118 |
| MW | 53 kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | EGRA, TIEG, TIEG1, EGR-alpha |
| Research Area | Epigenetics & Chromatin |
| Note | For research use only |
| NCBI | NP_005646 |

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml.

Rabbit Anti-KLF10 antibody, Catalog Number: orb576779, Paraffin Embedded Tissue: Human Heart cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-KLF10 Antibody Titration: 5.0 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Placenta.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review