KL Rabbit Polyclonal Antibody

• Catalog Number: orb333711
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Klotho
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KL
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 116kDa
• Target: KL
• UniProt ID: Q9UEF7
• Protein Sequence: Synthetic peptide located within the following region: HAQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGD
• NCBI: NP_004786
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti KL antibody, anti KLOT_HUMAN antibody, anti K
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human MKN45 Whole Cell, Antibody dilution: 5 ug/ml.

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 5 ug/ml.

prostate