KCNN2 Rabbit Polyclonal Antibody

• Catalog Number: orb329833
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KCNN2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Reactivity: Human, Monkey
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNN2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 26kDa
• Target: KCNN2
• UniProt ID: Q6PJI0
• Protein Sequence: Synthetic peptide located within the following region: KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ
• NCBI: NP_740721
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti KCa2.2 antibody, anti SK2 antibody, anti SKCA
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

Positive control (+): Human liver (LI), Negative control (-): HeLa (HL), Antibody concentration: 1 ug/mL.

Sample Type: Rhesus macaque spinal cord, Primary Antibody Dilution: 1:300, Secondary Antibody: Donkey anti Rabbit 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green: KCNN2, Gene Name: KCNN2.

WB Suggested Anti-KCNN2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human Muscle.