Cart summary

You have no items in your shopping cart.

KCNN2 Rabbit Polyclonal Antibody

SKU: orb329809

Description

Rabbit polyclonal antibody to KCNN2

Research Area

Cell Biology, Molecular Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Monkey, Rat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Yeast, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human KCNN2
TargetKCNN2
Protein SequenceSynthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM
Molecular Weight64kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti SK2 antibody, anti hSK2 antibody, anti SKCA2 antibody, anti KCa2.2 antibody

Similar Products

  • KCNN2 Rabbit Polyclonal Antibody [orb329833]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human, Monkey

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • KCNN2(SK2) Rabbit pAb Antibody [orb763814]

    IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • KCNN2 Antibody [orb676224]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • KCNN2 Antibody [orb1274933]

    IHC

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • KCNN2 Antibody [orb1281818]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

KCNN2 Rabbit Polyclonal Antibody

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

KCNN2 Rabbit Polyclonal Antibody

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

KCNN2 Rabbit Polyclonal Antibody

Positive control (+): Human liver (LI), Negative control (-): 293T (2T), Antibody concentration: 0.5 ug/mL.

KCNN2 Rabbit Polyclonal Antibody

Lanes: Rat brain section, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-biotin, streptavidin-diaminobenzidine, Secondary Antibody Dilution: 1:500, Gene Name: KCNN2.

KCNN2 Rabbit Polyclonal Antibody

Sample Type: Rhesus macaque spinal cord, Primary Antibody Dilution: 1:300, Secondary Antibody: Donkey anti Rabbit 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green: KCNN2, Gene Name: KCNN2.

KCNN2 Rabbit Polyclonal Antibody

WB Suggested Anti-KCNN2 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_067627

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

KCNN2 Rabbit Polyclonal Antibody (orb329809)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 530.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry