KCNN2 Rabbit Polyclonal Antibody

• Catalog Number: orb329809
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KCNN2
• Target: KCNN2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Monkey, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KCNN2
• Protein Sequence: Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM
• UniProt ID: Q9H2S1
• MW: 64kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti SK2 antibody, anti hSK2 antibody, anti SKCA2
• Note: For research use only
• NCBI: NP_067627

Sample Tissue: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

Positive control (+): Human liver (LI), Negative control (-): 293T (2T), Antibody concentration: 0.5 ug/mL.

Lanes: Rat brain section, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-biotin, streptavidin-diaminobenzidine, Secondary Antibody Dilution: 1:500, Gene Name: KCNN2.

Sample Type: Rhesus macaque spinal cord, Primary Antibody Dilution: 1:300, Secondary Antibody: Donkey anti Rabbit 488, Secondary Antibody Dilution: 1:500, Color/Signal Descriptions: Green: KCNN2, Gene Name: KCNN2.

WB Suggested Anti-KCNN2 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.