You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329808 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to KCNMA1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Reactivity | Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the c terminal region of human KCNMA1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 131kDa |
Target | KCNMA1 |
UniProt ID | Q12791 |
Protein Sequence | Synthetic peptide located within the following region: CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG |
NCBI | NP_001014797 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti BKTM antibody, anti DKFZp686K1437 antibody, a Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human Liver tissue using KCNMA1 antibody
Immunohistochemical staining of human Prostate tissue using KCNMA1 antibody
Immunohistochemical staining of human Pineal tissue using KCNMA1 antibody
Western blot analysis of human Jurkat tissue using KCNMA1 antibody
Western blot analysis of human HepG2 tissue using KCNMA1 antibody
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Equine, Hamster, Monkey, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating