KCNMA1 Rabbit Polyclonal Antibody

SKU: orb329933

Description

KCNMA1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of KCNMA1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human KCNMA1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNMA1
• Target: KCNMA1
• Protein Sequence: Synthetic peptide located within the following region: ESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITD
• Molecular Weight: 131kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti BKTM antibody, anti DKFZp686K1437 antibody, anti KCa1.1 antibody, anti MGC71881 antibody, anti MaxiK antibody, anti SAKCA antibody, anti SLO antibody, anti SLO-ALPHA antibody, anti mSLO1 antibody, anti SLO1 antibody, anti bA205K10.1 antibody

Quick Database Links

Gene Symbol

KCNMA1

UniProt

Q12791

RefSeq (Protein):NP_001014797