Cart summary

You have no items in your shopping cart.

KAT14 Rabbit Polyclonal Antibody (HRP)

KAT14 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2083835

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2083835
CategoryAntibodies
DescriptionKAT14 Rabbit Polyclonal Antibody (HRP)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen for Anti-CSRP2BP antibody is: synthetic peptide directed towards the N-terminal region of Human CSR2B
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP
MW86 kDa
UniProt IDQ9H8E8
Protein SequenceSynthetic peptide located within the following region: ESEDQASVDLSHDQSGDSLNSDEGDVSWMEEQLSYFCDKCQKWIPASQLR
NCBINP_065397.3
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Alternative namesATAC2, CRP2BP, CSRP2BP, PRO1194, dJ717M23.1
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.