KAT14 Rabbit Polyclonal Antibody

• Catalog Number: orb588019
• Category: Antibodies
• Description: Rabbit polyclonal antibody to KAT14
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen for Anti-CSRP2BP antibody is: synthetic peptide directed towards the N-terminal region of Human CSR2B
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 86 kDa
• Target: KAT14
• UniProt ID: Q9H8E8
• Protein Sequence: Synthetic peptide located within the following region: ESEDQASVDLSHDQSGDSLNSDEGDVSWMEEQLSYFCDKCQKWIPASQLR
• NCBI: NP_065397.3
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ATAC2, CRP2BP, CSRP2BP, PRO1194, dJ717M23.1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-CSR2B antibody Titration: 1 ug/ml, Sample Type: Human HepG2 Whole Cell.