JAZF1 Rabbit Polyclonal Antibody

SKU: orb577396

Description

Rabbit polyclonal antibody to JAZF1

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human JAZF1
• Target: JAZF1
• Protein Sequence: Synthetic peptide located within the following region: KKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFH
• Molecular Weight: 27kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

TIP27, ZNF802

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Lung Tumor, Antibody Dilution: 1.0 ug/ml.

Positive control (+): Human lung (LU), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0 ug/ml using anti-JAZF1 antibody (orb577396).

WB Suggested Anti-JAZF1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.

Quick Database Links

Gene Symbol

JAZF1

UniProt

Q86VZ6

RefSeq (Protein):NP_778231