You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human JAZF1 |
| Target | JAZF1 |
| Protein Sequence | Synthetic peptide located within the following region: KKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFH |
| Molecular Weight | 27kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−JAZF1 Rabbit Polyclonal Antibody [orb575886]
WB
Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish
Human
Rabbit
Polyclonal
Unconjugated
100 μlSUZ12 Rabbit Polyclonal Antibody [orb570411]
ELISA, ICC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human 293T Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Lung Tumor, Antibody Dilution: 1.0 ug/ml.

Positive control (+): Human lung (LU), Negative control (-): 293T (2T), Antibody concentration: 1 ug/ml.

Immunohistochemistry with Human Testis lysate tissue at an antibody concentration of 5.0 ug/ml using anti-JAZF1 antibody (orb577396).

WB Suggested Anti-JAZF1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.
Documents Download
Request a Document
Protocol Information
JAZF1 Rabbit Polyclonal Antibody (orb577396)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review














