JAZF1 Rabbit Polyclonal Antibody

• Catalog Number: orb575886
• Category: Antibodies
• Description: Rabbit polyclonal antibody to JAZF1
• Target: JAZF1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human JAZF1
• Protein Sequence: Synthetic peptide located within the following region: IDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLT
• UniProt ID: Q86VZ6
• MW: 27kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TIP27, ZNF802
• Note: For research use only
• NCBI: NP_778231

Sample Type: Hela, Antibody Dilution: 1.0 ug/ml.

Sample Type: HepG2, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/ml.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/ml.

Sample Type: NTERA2, Antibody Dilution: 1.0 ug/ml.

WB Suggested Anti-JAZF1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.