ITGAV Rabbit Polyclonal Antibody

• Catalog Number: orb586005
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ITGAV
• Target: ITGAV
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ITGAV
• Protein Sequence: Synthetic peptide located within the following region: PVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENG
• UniProt ID: E7EWZ6
• MW: 100kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CD51, MSK8, VNRA, VTNR
• Research Area: Cell Biology, Signal Transduction
• Note: For research use only
• NCBI: NP_001138471

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

Sample Tissue: Human 293T Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-ITGAV Antibody, Titration: 1.0 ug/ml, Positive Control: PANC1 Whole Cell.