You have no items in your shopping cart.
ISG15 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Porcine, Rabbit, Sheep |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ISG15 |
| Target | ISG15 |
| Protein Sequence | Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
| Molecular Weight | 17kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−HECT E3 ubiquitin ligase Rabbit Polyclonal Antibody [orb157475]
ICC, IF, IHC-Fr, IHC-P
Rat
Human, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlISG15 rabbit pAb Antibody [orb773893]
ELISA, IF, IHC, WB
Human, Mouse
Polyclonal
Unconjugated
100 μl, 50 μlISG15 Rabbit Polyclonal Antibody [orb628132]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: 1. Human NT-2 cells (60 ug), 2. mouse brain extracts (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000.


Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. ISG15 is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. ISG15 is supported by BioGPS gene expression data to be expressed in MCF7.

Application: IHC, Species+tissue/cell type: Mouse brain stem cells, Primary antibody dilution: 1:500, Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000.

WB Suggested Anti-ISG15 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human kidney.
Documents Download
Request a Document
Protocol Information
ISG15 Rabbit Polyclonal Antibody (orb584319)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








