You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592901 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to IRF8 |
Target | IRF8 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human IRF8 |
Protein Sequence | Synthetic peptide located within the following region: MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRC |
UniProt ID | Q02556 |
MW | 48kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ICSBP, IRF-8, ICSBP1, IMD32A, IMD32B, H-ICSBP |
Note | For research use only |
NCBI | NP_002154 |
Sample Tissue: Human DLD1 Whole Cell, Antibody Dilution: 1 ug/ml.
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/ml.
Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/ml.
Human kidney
WB Suggested Anti-IRF8 Antibody Titration: 1.25 ug/ml, Positive Control: Jurkat cell lysate.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |