IRF8 Rabbit Polyclonal Antibody

• Catalog Number: orb592900
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IRF8
• Target: IRF8
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IRF8
• Protein Sequence: Synthetic peptide located within the following region: MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRC
• UniProt ID: Q02556
• MW: 48kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ICSBP, IRF-8, ICSBP1, IMD32A, IMD32B, H-ICSBP
• Note: For research use only
• NCBI: NP_002154

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. An isoform containing the peptide sequence is present at 37 kDa and the protein may also be ubiquitinated.

Sample Tissue: Human DLD1 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1.0 ug/ml.

Immunohistochemistry with Human Intestine tissue.

Immunohistochemistry with Human Liver cell lysate tissue.

WB Suggested Anti-IRF8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.