Irf1 Rabbit Polyclonal Antibody

• Catalog Number: orb576140
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Irf1
• Target: Irf1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Guinea pig, Human, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Protein Sequence: Synthetic peptide located within the following region: HIDGKGYLLNEPGTQLSSVYGDFSCKEEPEIDSPRGDIGIGIQHVFTEMK
• UniProt ID: P15314
• MW: 37kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Irf, Irf-1, AU020929
• Note: For research use only
• NCBI: NP_032416

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-Irf1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Mouse Muscle.

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/ml.