IRF1 Rabbit Polyclonal Antibody

• Catalog Number: orb573758
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IRF1
• Target: IRF1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IRF1
• Protein Sequence: Synthetic peptide located within the following region: RMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPD
• UniProt ID: P10914
• MW: 36kDa
• Tested applications: IHC-P, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MAR, IRF-1
• Note: For research use only
• NCBI: NP_002189

IRF1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb573758 with 1:200 dilution. Western blot was performed using orb573758 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: IRF1 IP with orb573758 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate.

Rabbit Anti-IRF1 Antibody, Catalog Number: orb573758, Formalin Fixed Paraffin Embedded Tissue: Human Bone Marrow Tissue, Observed Staining: Nucleus, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-IRF1 Antibody, Catalog Number: orb573758, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-IRF1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.