IREB2 Rabbit Polyclonal Antibody

SKU: orb577631

Description

IREB2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of IREB2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human IREB2. This antibody reacts with Human, Mouse samples and is predicted to react with Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

−

Item 1 of 3

Tested Applications	WB
Reactivity	Human, Mouse
Predicted Reactivity	Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human IREB2
Target	IREB2
Protein Sequence	Synthetic peptide located within the following region: IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK
Molecular Weight	105kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

ACO3, IRP2, IRP2AD, NDCAMA, IRE-BP2, IRE-BP 2

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Application: Western blotting, Species+tissue/cell type: Mouse liver extract, How many ug'sof tissue/cell lysate run on the gel: 1. 60 ug mouse liver extract, 2. 60 ug mouse liver extract, 3. 60 ug mouse liver extract, Primary antibody dilution: 1:500, Secondary antibody: Anti-rabbit HRP, Secondary antibody dilution: 1:3000.

WB Suggested Anti-IREB2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Liver.

Quick Database Links

Gene Symbol

IREB2

UniProt

P48200

RefSeq (Protein):NP_004127

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_004127

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols