IREB2 Rabbit Polyclonal Antibody

SKU: orb577631

Description

Rabbit polyclonal antibody to IREB2

Research Area

Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IREB2
• Target: IREB2
• Protein Sequence: Synthetic peptide located within the following region: IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK
• Molecular Weight: 105kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ACO3, IRP2, IRP2AD, NDCAMA, IRE-BP2, IRE-BP 2

Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Application: Western blotting, Species+tissue/cell type: Mouse liver extract, How many ug'sof tissue/cell lysate run on the gel: 1. 60 ug mouse liver extract, 2. 60 ug mouse liver extract, 3. 60 ug mouse liver extract, Primary antibody dilution: 1:500, Secondary antibody: Anti-rabbit HRP, Secondary antibody dilution: 1:3000.

WB Suggested Anti-IREB2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Liver.

Quick Database Links

Gene Symbol

IREB2

UniProt

P48200

RefSeq (Protein):NP_004127