IREB2 Rabbit Polyclonal Antibody

• Catalog Number: orb577631
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IREB2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IREB2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 105kDa
• Target: IREB2
• UniProt ID: P48200
• Protein Sequence: Synthetic peptide located within the following region: IQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEK
• NCBI: NP_004127
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: ACO3, IRP2, IRP2AD, NDCAMA, IRE-BP2, IRE-BP 2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Application: Western blotting, Species+tissue/cell type: Mouse liver extract, How many ug'sof tissue/cell lysate run on the gel: 1. 60 ug mouse liver extract, 2. 60 ug mouse liver extract, 3. 60 ug mouse liver extract, Primary antibody dilution: 1:500, Secondary antibody: Anti-rabbit HRP, Secondary antibody dilution: 1:3000.

WB Suggested Anti-IREB2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Liver.