You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585390 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Irak1bp1 |
Target | Irak1bp1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Mouse |
Predicted Reactivity | Canine, Equine, Human, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Irak1bp1 |
Protein Sequence | Synthetic peptide located within the following region: WEGQTDDHQLSRLPGTLTVQQKIKSATIHAASKVFITFEVKGKEKKKKHL |
UniProt ID | Q9ESJ7 |
MW | 29kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | S, AI, Aabp3, Aip70, Simpl, AI851240, 4921528N06Ri Read more... |
Research Area | Epigenetics & Chromatin, Signal Transduction |
Note | For research use only |
NCBI | NP_075362 |
Expiration Date | 12 months from date of receipt. |
Sample Type: Mouse Testis lysates, Antibody dilution: 1.0 ug/ml.
IF, IHC-Fr, IHC-P, WB | |
Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
Biotin |