Irak1bp1 Rabbit Polyclonal Antibody

• Catalog Number: orb585390
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Irak1bp1
• Target: Irak1bp1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Canine, Equine, Human, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Irak1bp1
• Protein Sequence: Synthetic peptide located within the following region: WEGQTDDHQLSRLPGTLTVQQKIKSATIHAASKVFITFEVKGKEKKKKHL
• UniProt ID: Q9ESJ7
• MW: 29kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: S, AI, Aabp3, Aip70, Simpl, AI851240, 4921528N06Ri
• Research Area: Epigenetics & Chromatin, Signal Transduction
• Note: For research use only
• NCBI: NP_075362
• Expiration Date: 12 months from date of receipt.

Sample Type: Mouse Testis lysates, Antibody dilution: 1.0 ug/ml.