Cart summary

You have no items in your shopping cart.

Irak1bp1 Rabbit Polyclonal Antibody (FITC)

Irak1bp1 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2094666

Select Product Size
SizePriceQuantity
100 μl$ 680.00
100 μl Enquire
DispatchUsually dispatched within 5-10 working days
Catalog Numberorb2094666
CategoryAntibodies
DescriptionIrak1bp1 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityCanine, Equine, Human, Mouse, Porcine, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
PurificationAffinity Purified
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Irak1bp1
Protein SequenceSynthetic peptide located within the following region: WEGQTDDHQLSRLPGTLTVQQKIKSATIHAASKVFITFEVKGKEKKKKHL
UniProt IDQ9ESJ7
MW29kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesS, AI, Aabp3, Aip70, Simpl, AI851240, 4921528N06Ri
Read more...
NoteFor research use only
NCBINP_075362
Expiration Date12 months from date of receipt.