INSIG1 Rabbit Polyclonal Antibody

• Catalog Number: orb577458
• Category: Antibodies
• Description: Rabbit polyclonal antibody to INSIG1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human INSIG1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 25kDa
• Target: INSIG2
• UniProt ID: Q9Y5U4
• Protein Sequence: Synthetic peptide located within the following region: WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH
• NCBI: NP_057217
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: INSIG-2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human HT1080 Whole Cell, Antibody Dilution: 3 ug/ml.

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 2 ug/ml.

Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. INSIG2 is supported by BioGPS gene expression data to be expressed in 721_B.

Positive control (+): Human stomach (ST), Negative control (-): MCF7 (N10), Antibody concentration: 1 ug/ml.

WB Suggested Anti-INSIG1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Muscle.