INSIG1 Rabbit Polyclonal Antibody

• Catalog Number: orb577454
• Category: Antibodies
• Description: Rabbit polyclonal antibody to INSIG1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human INSIG1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36kDa
• Target: INSIG1
• UniProt ID: A4D2M9
• Protein Sequence: Synthetic peptide located within the following region: ITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGR
• NCBI: NP_938150
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CL6
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemistry with Liver tissue at an antibody concentration of 10 ug/ml using anti-INSIG1 antibody (orb577454).

Lanes: Lane 1: 50 ug human putamen lysate, Lane 2: 50 ug rat cortex lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Mouse anti-rabbit HRP, Secondary Antibody Dilution: 1:15000, Gene Name: INSIG1.

WB Suggested Anti-INSIG1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Spleen.