You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Influenza A virus |
| Tag | N-terminal 10xHis-tagged |
| Expression Region | 133-252aa |
| Protein Length | Partial |
| MW | 19.3 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | NRMGTVTTEAAFGLVCATCEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQRFK |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Recombinant Influenza A virus (H10N7) Matrix protein 1 Protein, N-His [orb2962026]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
19.56 kDa
1 mg, 50 μg, 100 μgInfluenza A virus M/Matrix protein 1 Human Monoclonal Antibody [orb2956497]
BLI, ELISA
Virus
Human
Monoclonal
Unconjugated
1 mg, 50 μg, 100 μgInfluenza A virus Matrix protein 2 Protein [orb1477862]
Greater than 90% as determined by SDS-PAGE.
12.5 kDa
in vitro E.coli expression system
100 μg, 20 μgInfluenza A virus Matrix protein 2 Protein [orb1477854]
Greater than 90% as determined by SDS-PAGE.
17.2 kDa
in vitro E.coli expression system
100 μg, 20 μgRecombinant Influenza A virus Matrix protein 2 (M2), partial [orb2658607]
Greater than 90% as determined by SDS-PAGE.
10.9 kDa
Mammalian cell
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Influenza A virus Matrix protein 1 protein (orb704973)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



