IL1B Rabbit Polyclonal Antibody

• Catalog Number: orb582285
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IL1B
• Target: IL1B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Canine, Equine, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL1B
• Protein Sequence: Synthetic peptide located within the following region: MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQL
• UniProt ID: P01584
• MW: 17
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: IL-1, IL1F2, IL1beta, IL1-BETA
• Note: For research use only
• NCBI: NP_000567

Positive control (+): Human lung (LU), Negative control (-): Human Ovary (OV), Antibody concentration: 3 ug/ml.

Human Macrophage

WB Suggested Anti-IL1B Antibody, Positive Control: Lane 1: 80 ug rat brain extract Lane 2: 80 ug mouse brain extract, Primary Antibody Dilution: 1:500, Secondary Antibody: IRDye 800 CW goat anti-rabbit, Secondry Antibody Dilution: 1:20000.

WB Suggested Anti-IL1B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Hela cell lysate.