IDH1 Rabbit Polyclonal Antibody

SKU: orb330780

Description

Rabbit polyclonal antibody to IDH1

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human IDH1
• Target: IDH1
• Protein Sequence: Synthetic peptide located within the following region: VSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQ
• Molecular Weight: 47kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti IDH antibody, anti IDP antibody, anti PICD antibody, anti IDCD antibody, anti IDPC antibody

Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. IDH1 is supported by BioGPS gene expression data to be expressed in HepG2.

Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. IDH1 is supported by BioGPS gene expression data to be expressed in MCF7.

Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.

Human Testis

Human Testis

WB Suggested Anti-IDH1 Antibody Titration: 1 ug/ml, Positive Control: Fetal liver cell lysate.

Quick Database Links

Gene Symbol

IDH1

UniProt

O75874

RefSeq (Protein):NP_005887