You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330780 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to IDH1 |
Target | IDH1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human IDH1 |
Protein Sequence | Synthetic peptide located within the following region: VSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQ |
UniProt ID | O75874 |
MW | 47kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti IDH antibody, anti IDP antibody, anti PICD an Read more... |
Note | For research use only |
NCBI | NP_005887 |
Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. IDH1 is supported by BioGPS gene expression data to be expressed in HepG2.
Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. IDH1 is supported by BioGPS gene expression data to be expressed in MCF7.
Sample Tissue: Rat Liver, Antibody dilution: 1 ug/ml.
Human Testis
Human Testis
WB Suggested Anti-IDH1 Antibody Titration: 1 ug/ml, Positive Control: Fetal liver cell lysate.
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Yeast | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-P, WB | |
Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-P, WB | |
Mouse, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |