Cart summary

You have no items in your shopping cart.

IDH1 Rabbit Polyclonal Antibody

SKU: orb330779

Description

Rabbit polyclonal antibody to IDH1

Research Area

Cell Biology, Immunology & Inflammation, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Yeast

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human IDH1
TargetIDH1
Protein SequenceSynthetic peptide located within the following region: MMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRG
Molecular Weight47 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti IDH antibody, anti IDP antibody, anti PICD antibody, anti IDCD antibody, anti IDPC antibody

Similar Products

  • Isocitrate dehydrogenase/IDH1 Rabbit Polyclonal Antibody [orb312127]

    FC,  ICC,  IF,  IHC,  IHC-Fr,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • IDH1 Rabbit Polyclonal Antibody [orb330780]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • IDH1 rabbit pAb Antibody [orb767021]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • IDH1 Rabbit Polyclonal Antibody [orb2622]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
  • IDH1 Antibody (N-term) [orb1428888]

    FC,  IF,  IHC-P,  WB

    Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    80 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

IDH1 Rabbit Polyclonal Antibody

Sample Tissue: Rat Brain, Antibody dilution: 1 ug/ml.

IDH1 Rabbit Polyclonal Antibody

Sample type: 1. HEPG2 (50 ug), 2. Drosophila extract (50 ug), Primary dilution: 1:1000, Secondary Antibody: mouse anti-Rabbit HRP, Secondary dilution: 1:5000.

IDH1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

IDH1 Rabbit Polyclonal Antibody

IDH1 antibody - C-terminal region (orb330779) validated by WB using HEPG2 lysate + Drosophila extract at 1:1000. IDH1 is supported by BioGPS gene expression data to be expressed in HepG2.

IDH1 Rabbit Polyclonal Antibody

Rabbit Anti-IDH1 Antibody, Paraffin Embedded Tissue: Human Testis, Antibody Concentration: 5 ug/ml.

IDH1 Rabbit Polyclonal Antibody

Rabbit Anti-IDH1 Antibody, Paraffin Embedded Tissue: Human Testis, Antibody Concentration: 5 ug/ml.

IDH1 Rabbit Polyclonal Antibody

Sample Type: Human glioma cells, Primary Antibody dilution: 1:200, Secondary Antibody: Anti-rabbit-GFP, Secondary Antibody dilution: 1:5000, Color/Signal Descriptions: 1. Red: Nucleus 2. Green: IDH 3. Merge, Gene Name: IDH1.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005887

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

IDH1 Rabbit Polyclonal Antibody (orb330779)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry