IDH1 antibody

• Catalog Number: orb330779
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IDH1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Yeast
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human IDH1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47 kDa
• Target: IDH1
• UniProt ID: O75874
• Protein Sequence: Synthetic peptide located within the following region: MMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRG
• NCBI: NP_005887
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti IDH antibody, anti IDP antibody, anti PICD an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Rat Brain, Antibody dilution: 1 ug/ml.

Sample type: 1. HEPG2 (50 ug), 2. Drosophila extract (50 ug), Primary dilution: 1:1000, Secondary Antibody: mouse anti-Rabbit HRP, Secondary dilution: 1:5000.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

IDH1 antibody - C-terminal region (orb330779) validated by WB using HEPG2 lysate + Drosophila extract at 1:1000. IDH1 is supported by BioGPS gene expression data to be expressed in HepG2.

Rabbit Anti-IDH1 Antibody, Paraffin Embedded Tissue: Human Testis, Antibody Concentration: 5 ug/ml.

Rabbit Anti-IDH1 Antibody, Paraffin Embedded Tissue: Human Testis, Antibody Concentration: 5 ug/ml.

Sample Type: Human glioma cells, Primary Antibody dilution: 1:200, Secondary Antibody: Anti-rabbit-GFP, Secondary Antibody dilution: 1:5000, Color/Signal Descriptions: 1. Red: Nucleus 2. Green: IDH 3. Merge, Gene Name: IDH1.