Cart summary

You have no items in your shopping cart.

    IDH1 antibody

    Catalog Number: orb330779

    DispatchUsually dispatched within 1 - 2 weeks
    $ 572.00
    Catalog Numberorb330779
    CategoryAntibodies
    DescriptionRabbit polyclonal antibody to IDH1
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsIHC, WB
    Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Yeast
    ReactivityHuman, Rat
    ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human IDH1
    Concentration0.5 mg/ml
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    ConjugationUnconjugated
    MW47 kDa
    TargetIDH1
    UniProt IDO75874
    Protein SequenceSynthetic peptide located within the following region: MMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRG
    NCBINP_005887
    StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Alternative namesanti IDH antibody, anti IDP antibody, anti PICD an
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    IDH1 antibody

    Host: Rat, Target Name: IDH1, Sample Tissue: Rat Brain, Antibody dilution: 1 ug/ml.

    IDH1 antibody

    Sample type: 1. HEPG2 (50 ug), 2. Drosophila extract (50 ug), Primary dilution: 1:1000, Secondary Antibody: mouse anti-Rabbit HRP, Secondary dilution: 1:5000.

    IDH1 antibody

    25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

    IDH1 antibody

    IDH1 antibody - C-terminal region (orb330779) validated by WB using HEPG2 lysate + Drosophila extract at 1:1000. IDH1 is supported by BioGPS gene expression data to be expressed in HepG2.

    IDH1 antibody

    Rabbit Anti-IDH1 Antibody, Paraffin Embedded Tissue: Human Testis, Antibody Concentration: 5 ug/ml.

    IDH1 antibody

    Rabbit Anti-IDH1 Antibody, Paraffin Embedded Tissue: Human Testis, Antibody Concentration: 5 ug/ml.

    IDH1 antibody

    Sample Type: Human glioma cells, Primary Antibody dilution: 1:200, Secondary Antibody: Anti-rabbit-GFP, Secondary Antibody dilution: 1:5000, Color/Signal Descriptions: 1. Red: Nucleus 2. Green: IDH 3. Merge, Gene Name: IDH1.

    • Isocitrate dehydrogenase/IDH1 Antibody [orb312127]

      FC,  ICC,  IF,  IHC,  IHC-Fr,  WB

      Hamster

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      10 μg, 100 μg
    • IDH1 antibody [orb330780]

      IHC,  WB

      Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep

      Human, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    • IDH1 Antibody [orb1244478]

      ELISA,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    • IDH1 antibody [orb52671]

      ELISA,  IF,  IHC,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μg, 50 μg
    • IDH1 Antibody [orb1260517]

      IF,  IP,  WB

      Human, Mouse, Rat

      Rabbit

      Polyclonal

      Unconjugated

      100 μl
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars