You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb330779 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to IDH1 |
Target | IDH1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Yeast |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human IDH1 |
Protein Sequence | Synthetic peptide located within the following region: MMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRG |
UniProt ID | O75874 |
MW | 47 kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti IDH antibody, anti IDP antibody, anti PICD an Read more... |
Note | For research use only |
NCBI | NP_005887 |
Sample Tissue: Rat Brain, Antibody dilution: 1 ug/ml.
Sample type: 1. HEPG2 (50 ug), 2. Drosophila extract (50 ug), Primary dilution: 1:1000, Secondary Antibody: mouse anti-Rabbit HRP, Secondary dilution: 1:5000.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.
IDH1 antibody - C-terminal region (orb330779) validated by WB using HEPG2 lysate + Drosophila extract at 1:1000. IDH1 is supported by BioGPS gene expression data to be expressed in HepG2.
Rabbit Anti-IDH1 Antibody, Paraffin Embedded Tissue: Human Testis, Antibody Concentration: 5 ug/ml.
Rabbit Anti-IDH1 Antibody, Paraffin Embedded Tissue: Human Testis, Antibody Concentration: 5 ug/ml.
Sample Type: Human glioma cells, Primary Antibody dilution: 1:200, Secondary Antibody: Anti-rabbit-GFP, Secondary Antibody dilution: 1:5000, Color/Signal Descriptions: 1. Red: Nucleus 2. Green: IDH 3. Merge, Gene Name: IDH1.
FC, IF, IHC-P, WB | |
Rat, Sheep | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-P, WB | |
Mouse, Sheep | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |