Human TXN2 protein

Catalog Number: orb54267

Catalog Number	orb54267
Category	Proteins
Description	Recombinant human TXN2 protein
Tag	N-terminal GST-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	38.9 kDa
UniProt ID	Q99757
Protein Sequence	TTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG
Protein Length	Full Length
Source	E.coli
Expression System	Expression Region: 60-166aa. Protein Length: Full Length
Expression Region	1-166aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	Thioredoxin-2 Read more...
Note	For research use only
Application notes	N-terminal GST-tagged: N-terminal GST-tagged1-349AA: 1-166AAFull Length : Full Length
Expiration Date	6 months from date of receipt.

Purity:	> 95% by SDS-PAGE.
Source:	KMP1471, Recombinant Human TXN2 Protein is produced by E.coli expression system. The target protein is expressed with sequence (Thr60-Gly166) of human TXN2 (Accession #Q99757) fused with a 6xHis Tag at the N-terminus.

Sizes Available: 50 μg, 500 μg

Human MTRX protein [orb49678]
Source:
E.coli
Sizes Available: 1 mg, 500 μg, 50 μg, 10 μg
Thioredoxin 2 (TXN2) Human Over-expression Lysate [orb1357070]
Sizes Available: 100 μg

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Source:	E. coli