You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human TNFSF14 protein
Catalog Number: orb605256
| Catalog Number | orb605256 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Tumor necrosis factor ligand superfamily member 14(TNFSF14),partial |
| Tag | C-terminal hFc-Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV |
| Protein Length | Partial |
| UniProt ID | O43557 |
| MW | 48.3 kDa |
| Application notes | Partial |
| Endotoxins | Not test. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 74-240aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Herpes virus entry mediator ligand (HVEM-L) (Herpe Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 2
Human TNFSF14 protein [orb705344]
Greater than 85% as determined by SDS-PAGE.
46.7 kDa
Mammalian cell
1 mg, 20 μg, 100 μg - Item 1 of 2
Human LIGHT Protein, hFc Tag [orb757459]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.4 kDa after removal of the signal peptide.
Mammalian
50 μg, 10 μg, 100 μg - Item 1 of 3
Recombinant human LIGHT (Trimer) protein, N-His-Flag (HEK293) [orb1516393]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 52-140 kDa based on Tris-Bis PAGE result.
50 μg - Item 1 of 2
Recombinant human LIGHT protein, C-His (HEK293) [orb1516394]
> 95% as determined by Tris-Bis PAGE
Due to glycosylation, the protein migrates to 25-30 kDa based on Tris-Bis PAGE result.
50 μg 
Human TNFSF14 protein [orb706862]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μg
