You have no items in your shopping cart.
Human TNFSF14 protein
SKU: orb605256
Featured
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | C-terminal hFc1-Myc-tagged |
| Molecular Weight | 48.3 kDa |
| Expression Region | 74-240aa |
| Protein Length | Partial |
| Protein Sequence | DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Herpes virus entry mediator ligand (HVEM-L) (Herpesvirus entry mediator ligand) (HVEML) (CD_antigen, CD258) (LIGHT)
Similar Products
−- Item 1 of 2
Human TNFSF14 protein [orb705344]
Greater than 85% as determined by SDS-PAGE.
46.7 kDa
Mammalian cell
1 mg, 20 μg, 100 μg 
Recombinant Human LIGHT Protein [orb2994034]
Unconjugated
SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 43.3 KDa. Observed: 45-60 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human LIGHT Protein [orb2994330]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 18.2 KDa. Observed: 18-24 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg- Item 1 of 2
Human LIGHT Protein, hFc Tag [orb757459]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.4 kDa after removal of the signal peptide.
Mammalian
10 μg, 100 μg, 50 μg - Item 1 of 1
_orb239744_wb_1.jpg)
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human TNFSF14 protein (orb605256)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 4-5 weeks