You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human TNFRSF9 protein
Catalog Number: orb594869
| Catalog Number | orb594869 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Tumor necrosis factor receptor superfamily member 9(TNFRSF9),partial (Active) |
| Tag | C-terminal Fc-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 44.2 kDa |
| UniProt ID | Q07011 |
| Protein Sequence | LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ |
| Protein Length | Extracellular Domain |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human 4-1BBL-His at 10μg/ml can bind Human 4-1BB-Fc, the ED50 of Human 4-1BB-Fc is 16.8 ng/ml. |
| Expression Region | 24-186aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Alternative names | CD137; ILA; TNFRSF9; 4-1BB ligand receptor; CDw137 Read more... |
| Note | For research use only |
| Application notes | Extracellular Domain |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Recombinant human TNFRSF9 protein, C-His-Avi (HEK293), Biotin conjugated [orb2328773]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 35-45 kDa based on Tris-Bis PAGE result.
20 μg, 100 μg - Item 1 of 1
- Item 1 of 1
Cynomolgus 4-1BB Protein, hFc Tag [orb1826724]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.4 kDa after removal of the signal peptide. The apparent molecular mass of c4-1BB-hFc is approximately 55-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Human TNFRSF9 protein [orb594867]
Greater than 95% as determined by SDS-PAGE.
44 kDa
Mammalian cell
10 μg, 50 μg, 1 mg, 500 μg - Item 1 of 1
Human TNFRSF9 protein [orb594868]
Greater than 95% as determined by SDS-PAGE.
18.1 kDa
Mammalian cell
10 μg, 50 μg, 1 mg, 500 μg
