You have no items in your shopping cart.
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Loaded Biotinylated Human OX40L-His on AR2G Biosensor, can bind Human OX40-Fc with an affinity constant of 70.3 nM as determined in BLI assay. ②Loaded Cynomolgus OX40L-His on HIS1K Biosensor, can bind Human OX40-Fc with an affinity constant of 165nM as determined in BLI assay. |
| Tag | C-terminal Fc-tagged |
| Expression Region | 29-216aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 46.8 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Tumor necrosis factor receptor superfamily member 4;ACT35 antigen;OX40L receptor;TAX transcriptionally-activated glycoprotein 1 receptor;TNFRSF4;OX40;CD134;Txgp1
Similar Products
−- Item 1 of 4
Human OX40 Protein, hFc-His tag [orb689383]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 47.2 kDa after removal of the signal peptide.
Mammalian
10 μg, 100 μg, 50 μg 
Recombinant Human OX40 Protein (Biotin) [orb2994141]
Biotin
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 48.6 KDa. Observed: 60-85 KDa, reducing conditions
20 μg, 100 μgRecombinant Human OX40 Protein [orb2994420]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 21 KDa. Observed: 38-45 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human OX40 Protein [orb2994421]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 46.3 KDa. Observed: 40-60 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human OX40 Protein [orb2994422]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 46.8 KDa. Observed: 70 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks