Human TNFRSF1B protein

• Catalog Number: orb705337
• Category: Proteins
• Description: Recombinant Human Tumor necrosis factor receptor superfamily member 1B(TNFRSF1B),partial
• Tag: C-terminal hFc-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 54.1 kDa
• UniProt ID: P20333
• Protein Sequence: LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD
• Protein Length: Partial
• Source: Mammalian cell
• Expression System: Expression Region: 23-257aa. Protein Length: Partial
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized TNF-α (CSB-YP023955HU) at 5 μg/ml can bind human TNFR2, the EC50 of human TNFR2 protein is 1.162-1.481 ng/ml.
• Expression Region: 23-257aa
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
• Alternative names: (Tumor necrosis factor receptor 2) (TNF-R2) (Tumor
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Expiration Date: 6 months from date of receipt.