You have no items in your shopping cart.
Human TNFRSF1B protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized TNF-α at 5 μg/ml can bind human TNFR2, the EC50 of human TNFR2 protein is 1.162-1.481 ng/ml. |
| Tag | C-terminal hFc1-tagged |
| Molecular Weight | 54.1 kDa |
| Expression Region | 23-257aa |
| Protein Length | Partial |
| Protein Sequence | LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human TNFRSF1B Protein, hFc Tag [orb1743387]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 51.3 kDa after removal of the signal peptide. The apparent molecular mass of TNFRSF1B-hFc is approximately 55-70kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgHuman TNFRSF1B protein [orb604426]
Greater than 90% as determined by SDS-PAGE.
46.3 kDa
E.coli
20 μg, 100 μg, 1 mgHuman TNFRSF1B protein [orb605393]
Greater than 85% as determined by SDS-PAGE.
25.9 kDa
Yeast
1 mg, 20 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized TNF-α at 5 μg/ml can bind human TNFR2, the EC50 of human TNFR2 protein is 1.162-1.481 ng/ml.

Measured by its binding ability in a functional ELISA. Immobilized LTA at 5 μg/ml can bind human TNFRSF1B, the EC50 is 1.632-2.699 ng/ml.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human TNFRSF1B protein (orb705337)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








