You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb605393 |
---|---|
Category | Proteins |
Description | Recombinant Human Tumor necrosis factor receptor superfamily member 1B(TNFRSF1B),partial |
Tag | C-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 25.9 kDa |
UniProt ID | P20333 |
Protein Sequence | LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD |
Protein Length | Partial |
Source | Yeast |
Expression System | Expression Region: 23-257aa. Protein Length: Partial |
Expression Region | 23-257aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Tumor necrosis factor receptor 2 , TNF-R2Tumor nec Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
26.0 kDa | |
Human TNFR2, His Tag (orb257880) is expressed from human 293 cells (HEK293). It contains AA Leu 23 - Asp 257 (Accession # AAA36755). |
Greater than 90% as determined by SDS-PAGE. | |
46.3 kDa | |
E.coli |
Greater than 95% as determined by SDS-PAGE. | |
26.2 kDa | |
Mammalian cell |
Greater than 95% as determined by SDS-PAGE. | |
54.1 kDa | |
Mammalian cell |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Filter by Rating