Human TNFRSF1B protein

• Catalog Number: orb594843
• Category: Proteins
• Description: Recombinant Human Tumor necrosis factor receptor superfamily member 1B(TNFRSF1B),partial (Active)
• Tag: C-terminal 6xHis-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 26.2 kDa
• UniProt ID: P20333
• Protein Sequence: LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD
• Protein Length: Extracellular Domain
• Source: Mammalian cell
• Expression System: Expression Region: 23-257aa. Protein Length: Extracellular Domain
• Biological Activity: The ED50 as determined by its ability to inhibit TNFa-mediated cytotoxicity using L‑929 mouse fibroblast cells treated with TNFa is less than 0.6 µg/mL.
• Expression Region: 23-257aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
• Alternative names: Tumor necrosis factor receptor superfamily member
• Note: For research use only
• Application notes: Extracellular Domain
• Expiration Date: 6 months from date of receipt.