Human TNFRSF1B protein

SKU: orb594843

Description

This Human TNFRSF1B protein spans the amino acid sequence from region 23-257aa. Purity: Greater than 95% as determined by SDS-PAGE.

Images & Validation

• Application Notes:
  Extracellular Domain

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human TNF alpha at 5μg/ml can bind Recombinant Human TNF RII (C-6His), the ED50 of Recombinant Human TNF RII (C-6His) is 0.212 ug/ml.
• Tag: C-terminal 6xHis-tagged
• Molecular Weight: 26.2 kDa
• Expression Region: 23-257aa
• Protein Length: Extracellular Domain
• Protein Sequence: LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD
• Purity: Greater than 95% as determined by SDS-PAGE.
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
• Disclaimer: For research use only

Alternative Names

Tumor necrosis factor receptor superfamily member 1B; Tumor necrosis factor receptor 2; Tumor necrosis factor receptor type II; p75; p80 TNF-alpha receptor; TBP-2; TBPII; TNFRSF1B; TNFBR; TNFR2

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P20333