You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human TNFRSF10B protein
Catalog Number: orb594847
| Catalog Number | orb594847 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Tumor necrosis factor receptor superfamily member 10B(TNFRSF10B),partial (Active) |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 15.19 kDa |
| UniProt ID | O14763 |
| Protein Sequence | ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE |
| Protein Length | Partial |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL is 9.96 ng/ml. |
| Expression Region | 56-182aa |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Alternative names | Tumor Necrosis Factor Receptor Superfamily Member Read more... |
| Note | For research use only |
| Application notes | Partial |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human TNFRSF10B Protein, mFc Tag [orb689451]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 40.5 kDa after removal of the signal peptide.
Mammalian
100 μg, 50 μg, 10 μg - Item 1 of 2
Recombinant human DR5 protein, C-His-Avi (HEK293) [orb1516306]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 20-25 kDa based on Tris-Bis PAGE result.
50 μg - Item 1 of 2
Recombinant human DR5 protein, C-His-Avi (HEK293), Biotin conjugated [orb2328725]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 20-25 kDa based on Tris-Bis PAGE result.
20 μg - Item 1 of 1
Mouse TNFRSF10B Protein, hFc Tag [orb1290884]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 40.3 kDa after removal of the signal peptide. The apparent molecular mass of mTNFRSF10B-hFc is approximately 40-55 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg 
Human TNFRSF10B protein [orb392583]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
10 μg, 500 μg, 50 μg
