You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human TFF3 protein
Catalog Number: orb604405
| Catalog Number | orb604405 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Trefoil factor 3(TFF3),partial |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | ANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF |
| Protein Length | Partial |
| UniProt ID | Q07654 |
| MW | 33.2 kDa |
| Application notes | Partial |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 29-80aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Intestinal trefoil factor (hITF) (Polypeptide P1.B Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human TFF3 protein (Active) [orb359256]
> 97% as determined by SDS-PAGE and HPLC.
6.6 kDa
E.Coli
100 μg, 500 μg, 5 μg - Item 1 of 1
Human TFF3 protein [orb605389]
Greater than 90% as determined by SDS-PAGE.
7.5 kDa
Yeast
1 mg, 100 μg, 20 μg - Item 1 of 1
- Item 1 of 1
Human Trefoil Factor-3 protein [orb80106]
FA, HPLC, SDS-PAGE
Unconjugated
> 95.0% as by SDS-PAGE.
5 μg, 100 μg, 500 μg - Item 1 of 1
Human TFF3 protein [orb223941]
SDS-PAGE
Unconjugated
> 95% by SDS-PAGE and HPLC analyses.
6.6 kDa
E. coli
5 μg, 100 μg, 500 μg
