You have no items in your shopping cart.
Featured
Description
Research Area
Neuroscience
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Baculovirus |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal MBP-tagged and C-terminal 6xHis-tagged |
| Expression Region | 29-147aa |
| Protein Length | Full Length of Mature Protein |
| MW | 57.8 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−RNS4
Similar Products
−- Item 1 of 3
Human RNASE4 Protein, His Tag [orb1173787]
Unconjugated
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 14.6 kDa after removal of the signal peptide. The apparent molecular mass of RNASE4-His is approximately 10-15 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μg - Item 1 of 2
Mouse RNASE4 Protein, hFc Tag [orb1173684]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 40.0 kDa after removal of the signal peptide.The apparent molecular mass of mRNASE4-hFc is approximately35-55 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg - Item 1 of 1
Human RNASE4 Protein, hFc Tag [orb1173786]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 40 kDa after removal of the signal peptide.The apparent molecular mass of RNASE4-hFc is approximately 40-55 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg - Item 1 of 1
Human RNASE4 protein [orb595016]
Greater than 85% as determined by SDS-PAGE.
17.8 kDa
Baculovirus
1 mg, 20 μg, 100 μg - Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Human RNASE4 protein (orb595015)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-6 weeks