Human PAX8 protein

SKU: orb604296

Description

This Human PAX8 protein spans the amino acid sequence from region 1-450aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Stem Cell & Developmental Biology

Images & Validation

• Application Notes:
  Full Length

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Expression Region: 1-450aa
• Protein Length: Full Length
• MW: 55.7 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

OTTHUMP00000158659, OTTHUMP00000158660, OTTHUMP00000203723, OTTHUMP00000203724, Paired box 8, Paired box gene 8, paired box homeotic gene 8, Paired box protein Pax 8, Paired box protein Pax-8, Paired domain gene 8, PAX 8, PAX8, PAX8_HUMAN

Quick Database Links

UniProt

Q06710