You have no items in your shopping cart.
Human interleukin 6 (IL-6) 29-212 aa
SKU: orb1729595
Description
Research Area
Immunology & Inflammation
Images & Validation
−
| Tested Applications | SDS-PAGE |
|---|---|
| Application Notes |
Key Properties
−| Source | E.coli |
|---|---|
| Species/Host | E. coli |
| Expression System | Intercellular |
| Biological Origin | Recombinant protein expressed as His tage protein in E.coli |
| Reactivity | Human, Mouse |
| Tag | Histidine |
| Molecular Weight | ~22 kDa |
| Protein Sequence | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Purity | ≥85% |
| Endotoxins | Not tested |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | After reconstitution, store at -20°C; Avoid repeated freeze thaw |
|---|---|
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | No preservative |
| Concentration | 1mg/mL |
| Expiration Date | 6 months from date of receipt. |
| Hazard Information | For Research use only |
| Disclaimer | For research use only |
Alternative Names
−B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
SDS-PAGE
Sodium Dodecyl Sulphate PolyAcrylamide Gel Electrophoresis
Human interleukin 6 (IL-6) 29-212 aa (orb1729595)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review