Human IL4R protein

Catalog Number: orb594782

Catalog Number	orb594782
Category	Proteins
Description	Recombinant Human Interleukin-4 receptor subunit alpha(IL4R),partial (Active)
Tag	C-terminal Fc-tagged
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	50.2 kDa
UniProt ID	P24394
Protein Sequence	MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQ
Protein Length	Extracellular Domain
Source	Mammalian cell
Expression System	Expression Region: 26-231aa. Protein Length: Extracellular Domain
Biological Activity	The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF‑1 human erythroleukemic cells is less than 20 ng/ml.
Expression Region	26-231aa
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alternative names	Interleukin-4 receptor subunit alpha; IL-4 recepto Read more...
Note	For research use only
Application notes	Extracellular Domain
Expiration Date	6 months from date of receipt.

Item 1 of 1

Conjugation:	Unconjugated
Purity:	95%
MW:	50.2 kDa & 63.1 kDa
Source:	Human IL-4 R alpha & IL-13 R alpha 1 Protein, Fc Tag&Fc Tag (orb1818945) is expressed from human 293 cells (HEK293). It contains AA Met 26 - His 232 & Gly 22 - Thr 343 (Accession # P24394-1 & NP_001551.1).

Sizes Available: 100 μg, 1 mg

Purity:	Greater than 95% as determined by SDS-PAGE.
MW:	24.4 kDa
Source:	Mammalian cell