You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb594782 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-4 receptor subunit alpha(IL4R),partial (Active) |
| Tag | C-terminal Fc-tagged |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQ |
| Protein Length | Extracellular Domain |
| UniProt ID | P24394 |
| MW | 50.2 kDa |
| Application notes | Extracellular Domain |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①The ED50 as determined by its ability to inhibit IL-4-dependent proliferation of TF‑1 human erythroleukemic cells is 5-20 ng/ml.②Measured by its binding ability in a functional ELISA. Immobilized Human IL-4 RA-Fc at 5μg/ml can bind Human IL-4 (Biotinylated by NHS-biotin prior to testing), the ED50 of Human IL-4 is 2.43 ng/ml. |
| Expression Region | 26-231aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Interleukin-4 receptor subunit alpha; IL-4 recepto Read more... |
| Research Area | Immunology & Inflammation |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
SDS-PAGE: Greater than 95% as determined by SDS-PAGE. (QC verified) | |
Predicted: 26.2 KDa. Observed: 35-65 KDa, reducing conditions |
Unconjugated | |
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. | |
Predicted: 50.2 KDa. Observed: 60-70 KDa, reducing conditions |
Unconjugated | |
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. | |
Predicted: 24.4 KDa. Observed: 35-60 KDa, reducing conditions |
Unconjugated | |
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. | |
Predicted: 50.2 KDa. Observed: 65-86 KDa, reducing conditions |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review