You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human IL1B protein
Catalog Number: orb604189
| Catalog Number | orb604189 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Interleukin-1 beta(IL1B) |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P01584 |
| MW | 44.4 kDa |
| Application notes | Full Length of Mature Protein |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 117-269aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Catabolin |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human IL1B protein (Active) [orb358966]
> 97% as determined by SDS-PAGE and HPLC.
17.3 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 3
Human IL1B protein [orb383023]
Greater than 90% as determined by SDS-PAGE.
33.4 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 3
IL1B purified MaxPab rabbit polyclonal antibody (D01P) [orb2292730]
PLA, WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μg - Item 1 of 2
Human IL1B Protein, hFc Tag [orb1173751]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.5 kDa after removal of the signal peptide.The apparent molecular mass of IL1B-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg - Item 1 of 1
Human IL1B Protein [orb1478116]
Greater than 90% as determined by SDS-PAGE.
21.5 kDa
E.coli
20 μg, 100 μg, 1 mg
