You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb383023 |
---|---|
Category | Proteins |
Description | Recombinant human IL1B protein. |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 33.4 kDa |
UniProt ID | P01584 |
Protein Sequence | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | Expression Region: 117-269aa. Protein Length: Full Length of Mature Protein |
Expression Region | 117-269aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Catabolin Read more... |
Note | For research use only |
Application notes | E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
63.9 kDa | |
Human IL-1 RII, Fc Tag (orb257592) is expressed from human 293 cells (HEK293). It contains AA Phe 14 - Glu 343 (Accession # NP_004624.1). |
> 97% as determined by SDS-PAGE and HPLC. | |
17.3 kDa | |
E.Coli |
Unconjugated | |
95% | |
62.4 kDa | |
Human IL-18 R1, Fc Tag (orb257584) is expressed from human 293 cells (HEK293). It contains AA Ala 19 - Arg 329 (Accession # AAH69575). |
Unconjugated | |
95% | |
40.2 kDa | |
Human IL-1 RAcP, His Tag (orb257622) is expressed from human 293 cells (HEK293). It contains AA Ser 21 - Glu 359 (Accession # Q9NPH3). |
Unconjugated | |
98% | |
38.9 kDa | |
Human IL-1 RII, His Tag (orb257591) is expressed from human 293 cells (HEK293). It contains AA Phe 14 - Glu 343 (Accession # NP_004624.1). |
Filter by Rating